General Information

  • ID:  hor000236
  • Uniprot ID:  A0A161R521(58-75)
  • Protein name:  ???PDH
  • Gene name:  PDH
  • Organism:  Cancer borealis (Jonah crab)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  NSELINSILGLPKVMNDA
  • Length:  18(58-75)
  • Propeptide:  MRSAVVVAVLVVVALTALLTQGQDLKYQEREMVAELAQQIYRVAQAPWAGAVGPHKRNSELINSILGLPKVMNDAGRR
  • Signal peptide:  MRSAVVVAVLVVVALTALLTQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A161R521-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000236_AF2.pdbhor000236_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 223165 Formula: C83H142N22O28S
Absent amino acids: CFHQRTWY Common amino acids: LN
pI: 4.18 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: 18.33 Boman Index: -1406
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 130
Instability Index: 3582.78 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16214114
  • Title:  Identification of Neuropeptides From the Decapod Crustacean Sinus Glands Using Nanoscale Liquid Chromatography Tandem Mass Spectrometry